The domain within your query sequence starts at position 105 and ends at position 140; the E-value for the FAD_binding_3 domain shown below is 3.5e-7.

NKSVLVVGAGPAGLAAARQLHNFGMKVTVLEAKDRI

FAD_binding_3

FAD_binding_3
PFAM accession number:PF01494
Interpro abstract (IPR002938):

This domain is involved in FAD binding in a number of enzymes.

GO function:FAD binding (GO:0071949)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_3