The domain within your query sequence starts at position 219 and ends at position 362; the E-value for the FAD_binding_4 domain shown below is 3.2e-43.
PDIVVWPTCHDDVVKIVNLACKYNLCIIPIGGGTSVSYGLMCPADETRTIISLDTSQMNR ILWVDENNLTAHVEAGITGQDLERQLKESGYCTGHEPDSLEFSTVGGWISTRASGMKKNI YGNIEDLVVHMKMVTPRGVIEKSS
FAD_binding_4 |
---|
PFAM accession number: | PF01565 |
---|---|
Interpro abstract (IPR006094): | Various enzymes use FAD as a co-factor, most of these enzymes are oxygen-dependent oxidoreductases, containing a covalently bound FAD group which is attached to a histidine via an 8-alpha-(N3-histidyl)-riboflavin linkage. One of the enzymes Vanillyl-alcohol oxidase (VAO, EC 1.1.3.38 ) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110 [ (PUBMED:10984479) ]. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyses the oxidation of a wide variety of substrates, ranging from aromatic amines to 4-alkylphenols. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity (GO:0016491), flavin adenine dinucleotide binding (GO:0050660) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_4