The domain within your query sequence starts at position 239 and ends at position 419; the E-value for the FAD_binding_5 domain shown below is 1e-44.

ERTTWIAPGTLNDLLELKMKHPSAPLVIGNTYLGLHMKFTDVSYPIIISPARILELFVVT
NTKQGLTLGAGLSLTQVKNVLSDVVSRLPKEKTQIYCALLKQLKTLAGQQIRNVASLGGH
IISRLPTSDLNPILGIGNCILNVASTEGIQQIPLNDHFLAGVPDAILKPEQVLISVFVPR
S

FAD_binding_5

FAD_binding_5
PFAM accession number:PF00941
Interpro abstract (IPR002346):

Oxidoreductases, that also bind molybdopterin, have essentially no similarity outside this common domain. They include aldehyde oxidase (EC 1.2.3.1), that converts an aldehyde and water to an acid and hydrogen peroxide, and xanthine dehydrogenase (EC 1.1.1.204), that converts xanthine to urate. These enzymes require molybdopterin and FAD as cofactors and have and two 2FE-2S clusters. Another enzyme that contains this domain is the Pseudomonas thermocarboxydovorans carbon monoxide oxygenase.

GO process:oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity (GO:0016491)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_5