The domain within your query sequence starts at position 20 and ends at position 117; the E-value for the FAD_binding_6 domain shown below is 4.7e-23.
AFHISTMEKVTKDTYLVRFTLPGNSRLGLRPGQHLILRGVVDGLEIQRAYTPISPVTAEG YFDVLIKCYRTGLMSQYVESWRTGDTAFWRGPFGSFLY
FAD_binding_6 |
---|
PFAM accession number: | PF00970 |
---|---|
Interpro abstract (IPR008333): | These sequences represent the FAD-binding domain found in NADH:cytochrome b5 reductases and nitrate reductases. To date, the 3D-structures of the flavoprotein domain of Zea mays (Maize) nitrate reductase [ (PUBMED:7812715) ] and of pig NADH:cytochrome b5 reductase [ (PUBMED:7893687) ] have been solved. The overall fold is similar to that of ferredoxin:NADP + reductase [ (PUBMED:8027025) ]: the FAD-binding domain (N-terminal) has the topology of an anti-parallel beta-barrel, while the NAD(P)-binding domain (C-terminal) has the topology of a classical pyridine dinucleotide-binding fold (i.e. a central parallel beta-sheet flanked by 2 helices on each side). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_6