The domain within your query sequence starts at position 21 and ends at position 128; the E-value for the FAD_binding_6 domain shown below is 2.1e-36.

PLRLIDKEVISPDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDK
GFVDLVVKVYFKDTHPKFPAGGKMSQYLENMKIGDTIEFRGPNGLLVY

FAD_binding_6

FAD_binding_6
PFAM accession number:PF00970
Interpro abstract (IPR008333):

These sequences contain an oxidoreductase FAD-binding domain.

To date, the 3D-structures of the flavoprotein domain of Zea mays (Maize) nitrate reductase [(PUBMED:7812715)] and of pig NADH:cytochrome b5 reductase [(PUBMED:7893687)] have been solved. The overall fold is similar to that of ferredoxin:NADP+ reductase [(PUBMED:8027025)]: the FAD-binding domain (N-terminal) has the topology of an anti-parallel beta-barrel, while the NAD(P)-binding domain (C-terminal) has the topology of a classical pyridine dinucleotide-binding fold (i.e. a central parallel beta-sheet flanked by 2 helices on each side).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_6