The domain within your query sequence starts at position 254 and ends at position 351; the E-value for the FAD_binding_8 domain shown below is 1.5e-27.
QQKVVITKVVMHPSNVLELQMRKRGFSMEVGQYIFVNCPSISFLEWHPFTLTSAPEEEFF SVHIRAAGDWTRNLIRTFEQQHSPMPRIEVDGPFGTVS
FAD_binding_8 |
---|
PFAM accession number: | PF08022 |
---|---|
Interpro abstract (IPR013112): | This FAD binding domain is associated with ferric reductase NAD binding proteins and the heavy chain of Cytochrome b-245. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity (GO:0016491) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_8