The domain within your query sequence starts at position 1 and ends at position 177; the E-value for the FAIM1 domain shown below is 3e-98.

MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWMFKLVGKETFFVGAAK
TKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTSTWVLRLDGEDLRVVLEKDTMDV
WCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIPEL

FAIM1

• PFAM accession number: PF06905
• Interpro abstract (IPR010695):

  FAIM1 (Fas apoptotic inhibitory molecule 1) plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells [ (PUBMED:10075978) ].

• GO process: negative regulation of apoptotic process (GO:0043066)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAIM1