The domain within your query sequence starts at position 2 and ends at position 174; the E-value for the FAIM1 domain shown below is 2.2e-85.
KIAAIWDVILSDGVHKIEFEHGTTSGKRVVYVDGKEVIRKEWMFPLVGKETFCVGAAKNK AIIRILSGKGCGFSYTLEIDGKSFRKFVENRSKTTNTWVLHLDDKDFRIVLEKPTMDVWC NGKIVESVGEFVDDGTETHFSVGNHGCYIKAVSSGKKREGIIHTLIVDNREIP
FAIM1 |
---|
PFAM accession number: | PF06905 |
---|---|
Interpro abstract (IPR010695): | FAIM1 (Fas apoptotic inhibitory molecule 1) plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells [ (PUBMED:10075978) ]. |
GO process: | negative regulation of apoptotic process (GO:0043066) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAIM1