The domain within your query sequence starts at position 1 and ends at position 204; the E-value for the FAM101 domain shown below is 5.6e-96.

MVGRLSLQDVPELVDTKKKGDGVLDSPDSGLPPSPSPSHWGLAATAGGGGERAPVAGTLE
PDAAVTPIVPNPASLTHSLAAICSPRLCPLSFGEGVEFDPLPPKEIKYTSSVKYDSERHF
IDDVQMPLGLVVASCSQTVTCIPNCTWRNYKAEVRFEPRPKPARFLSTTIVYPKYPKTVY
TTTLDYNCHKKLRRFLSSVELEAT

FAM101

 FAM101
PFAM accession number:PF15068
Interpro abstract (IPR028215):

This protein family includes the actin regulators, Refilin A and B. Refilin (also known as Cfm or FAM101) is thought to stabilise peri-nuclear actin filament bundles, important in fibroblasts. Refilin is important as changes in localisation and shape in the nucleus plays a role in cellular and developmental processes [ (PUBMED:21709252) ]. Refilins are essential partner molecules of Filamin B involved in regulating differentiation and proliferation of chondryocytes [ (PUBMED:24436304) ].

GO process:regulation of chondrocyte development (GO:0061181), actin filament bundle organization (GO:0061572)
GO function:filamin binding (GO:0031005)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM101