The domain within your query sequence starts at position 75 and ends at position 185; the E-value for the FAM104 domain shown below is 3.1e-58.
RKRRRNGSDDDNHPPPQTKRSSRNPIFQDSWDTESSSSDSGGSSSSSSINSPDRASGPES SLSHTIPGSCPSTPQPMPEQSALCQGPYFHINQTLKEAHFHSLQHRGRPPT
FAM104 |
 |
|---|
| PFAM accession number: | PF15434 |
|---|---|
| Interpro abstract (IPR029222): | This entry represents a group of eukaryotic proteins that are typically between 113 and 185 amino acids in length. These proteins contain a conserved SLQ sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM104