The domain within your query sequence starts at position 141 and ends at position 262; the E-value for the FAM110_C domain shown below is 1.2e-32.

DTPEATGKRAVCPTCSLPLSEKERFFNYCGLERALVEVLGAERFSPQSWGAEHGPQVATS
PPPGSGDTSDWTSSDRDAGSPDCAGGGGGSEAAGSARDGRPTVSVVERNARVIQWLYGCQ
RA

FAM110_C

FAM110_C
PFAM accession number:PF14160
Interpro abstract (IPR025741):

This entry represents the C terminus of a family of proteins that colocalise with the centrosome/microtubule organisation centre in interphase and at the spindle poles in mitosis [(PUBMED:17499476)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM110_C