The domain within your query sequence starts at position 247 and ends at position 358; the E-value for the FAM110_C domain shown below is 2.2e-50.
SRRPSLQRSKSDLSDRYFRVDADVERFFNYCGLDPEELENLGMENFARANSDIISLNFRS ASMISSDCEQSQDSNSDLRNDDSANDRVPYGISAIERNARIIKWLYSIKQAR
FAM110_C |
![]() |
---|
PFAM accession number: | PF14160 |
---|---|
Interpro abstract (IPR025741): | This entry represents the C terminus of a family of proteins that colocalise with the centrosome/microtubule organisation centre in interphase and at the spindle poles in mitosis [ (PUBMED:17499476) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM110_C