The domain within your query sequence starts at position 5 and ends at position 79; the E-value for the FAM110_N domain shown below is 1.4e-14.

SPTTPSRGRTPSAVERLEADKAKYVKTHQVIVRRQEPALRGGPGPLTPHPCNELGASASP
RTPGPARRGSGRRQP

FAM110_N

FAM110_N
PFAM accession number:PF14161
Interpro abstract (IPR025739):

This entry represents the N terminus of a family of proteins that colocalise with the centrosome/microtubule organisation centre in interphase and at the spindle poles in mitosis [(PUBMED:17499476)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM110_N