The domain within your query sequence starts at position 1 and ends at position 237; the E-value for the FAM117 domain shown below is 1e-83.

MRDKATQTPSCWAEEGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQSSRHSKEKDR
QSPLHGNHITISHTQAIGSRSVPMPLSNISVPKSSVSRVPCNVEGISPELEKVFIKENNG
KEEVSKPLDIPDGRRAPLPAHYRSSSTRSIDTQTPSVQERSSSCSSHSPCVSPFCPPESQ
DGSPCSTEDLLYDRDKDSGSSSPLPKYASSPKPNNSYMFKREPPEGCERVKVFEEMA

FAM117

FAM117
PFAM accession number:PF15388
Interpro abstract (IPR026642): This family includes glucocorticoid-induced transcript 1 protein, a protein of unkown function that is expressed at specific stages of T-cell and sperm maturation [(PUBMED:12557054)], and uncharacterised proteins FAM117A and FAM117B.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM117