The domain within your query sequence starts at position 1 and ends at position 94; the E-value for the FAM117 domain shown below is 3.9e-33.
MRDKATQTPSCWAEEGAEKRSHQRSASWGSADQLKEIAKLRQQLQRSKQSSRHSKEKDRQ SPLHGNHITISHTQAIGSRSVPMPLSNISVPKSS
FAM117 |
 |
|---|
| PFAM accession number: | PF15388 |
|---|---|
| Interpro abstract (IPR026642): | This family includes glucocorticoid-induced transcript 1 protein, a protein of unkown function that is expressed at specific stages of T-cell and sperm maturation [ (PUBMED:12557054) ], and uncharacterised proteins FAM117A and FAM117B. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM117