The domain within your query sequence starts at position 62 and ends at position 258; the E-value for the FAM131 domain shown below is 1.4e-47.

QTTNGYISDSRACPSNYSVAALATSSLVGVVQSIKDHITKPTAMARGRVAHLIEWKGWSA
QQSGWELSPAEDEHYCCLPDELREARFAAGVAEQFAITEATLSAWSSLDDEELQPEDSTQ
GAFQLQDLESIYLQDSLLSGPSQDDSLLACSPGLTLNDGWPSPEEPPSPTQQHHRQRLPG
AQGLDDRAHLHGSLPSV

FAM131

FAM131
PFAM accession number:PF15010
Interpro abstract (IPR026782): This family represents a group of uncharacterised proteins known as FAM131.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM131