The domain within your query sequence starts at position 49 and ends at position 341; the E-value for the FAM131 domain shown below is 7.4e-128.

MEDTTSILPKLKRNSNAYGIGALAKSSFSGISRSMKDHVTKPTAMGQGRVAHMIEWQGWG
KAPTIQPQHSHEAVRRDTDAYSDLSDGEKEARFLAGVMEQFAISEATLMAWSSMDGEDMS
VNSTQEPLDCNYSDNYQELMESQDALAQAPMDGWPHSYVSQGMYCLGSSDAWEASDQSLI
ASPATGSYLGPAFDDSQPSLHDMGPSQPASGYSAQEPPPLLGVDTDWASEVGGVELARGP
VEEEKRPLAPEEEEDAGCRDLESLSPREDPEMSTALSRKVSDVTSSGVQSFDE

FAM131

FAM131
PFAM accession number:PF15010
Interpro abstract (IPR026782): This family represents a group of uncharacterised proteins known as FAM131.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM131