The domain within your query sequence starts at position 32 and ends at position 150; the E-value for the FAM150 domain shown below is 5.3e-59.

DRQTLLRLLVELVQELKKFHIGDSKRLQLLGESDFALGRREATDYGADQEEQRVEIVPRD
LRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPMCME

FAM150

FAM150
PFAM accession number:PF15129
Interpro abstract (IPR029364):

This entry includes FAM150A and FAM150B proteins from vertebrates. FAM150A/B are activating ligands for the receptor anaplastic lymphoma kinase (ALK) and the receptor leukocyte tyrosine kinase (LTK) [(PUBMED:26630010), (PUBMED:26418745)].

GO function:receptor signaling protein tyrosine kinase activator activity (GO:0030298), receptor tyrosine kinase binding (GO:0030971)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM150