The domain within your query sequence starts at position 32 and ends at position 150; the E-value for the FAM150 domain shown below is 5.3e-59.
DRQTLLRLLVELVQELKKFHIGDSKRLQLLGESDFALGRREATDYGADQEEQRVEIVPRD LRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPMCME
FAM150 |
 |
|---|
| PFAM accession number: | PF15129 |
|---|---|
| Interpro abstract (IPR029364): | This entry includes FAM150A and FAM150B proteins from vertebrates. FAM150A/B are activating ligands for the receptor anaplastic lymphoma kinase (ALK) and the receptor leukocyte tyrosine kinase (LTK) [ (PUBMED:26630010) (PUBMED:26418745) ]. |
| GO function: | receptor tyrosine kinase binding (GO:0030971), receptor signaling protein tyrosine kinase activator activity (GO:0030298) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM150