The domain within your query sequence starts at position 1 and ends at position 168; the E-value for the FAM163 domain shown below is 7.9e-65.

MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKGTDGEDAEEEEEEEEHGLSIHPR
VPACNACSSHVLDGRGGLAPLTSESCSQPCGVASHCTTCSPYRTPFYIRTADMVPNGGGG
ERLSFAPTHYKEGGTPSLKLAAPQNYPVTWPSSGHEAFTNPRAISTDV

FAM163

FAM163
PFAM accession number:PF15069
Interpro abstract (IPR029379):

This protein family is alternatively named Neuroblastoma-derived secretory proteins. Highly expressed in neuroblastoma compared to other tissues, suggesting that it may be used as a marker for metastasis in bone marrow [(PUBMED:17208556)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM163