The domain within your query sequence starts at position 1 and ends at position 168; the E-value for the FAM163 domain shown below is 7.9e-65.
MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKGTDGEDAEEEEEEEEHGLSIHPR VPACNACSSHVLDGRGGLAPLTSESCSQPCGVASHCTTCSPYRTPFYIRTADMVPNGGGG ERLSFAPTHYKEGGTPSLKLAAPQNYPVTWPSSGHEAFTNPRAISTDV
FAM163 |
---|
PFAM accession number: | PF15069 |
---|---|
Interpro abstract (IPR029379): | This protein family is alternatively named Neuroblastoma-derived secretory proteins. Highly expressed in neuroblastoma compared to other tissues, suggesting that it may be used as a marker for metastasis in bone marrow [ (PUBMED:17208556) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM163