The domain within your query sequence starts at position 89 and ends at position 371; the E-value for the FAM178 domain shown below is 3.4e-115.
QEKRMLVEKFSVSLQVISPVHPGETVFLPRRHPLPCFLDSSRLKPHSPLEELFLRSSLPE QLSFLHNGLLSNLYLHAADCPQPLLQWLFQLLTWPPETSSRAFGLLWDLSIDGLFRQPDE DMHFWCPSLQEVKEVFSSLGAYNPALYPQGPFQHSARVLESEASLDSQDPPQEVALDIKL NYIYKFLTLCLLVRPVSYTDASILDLMELLCRAGLDVGLCLLPKTDLQQLLLLLLERIQE WPGKLQPLCCALSWVSDHHHNLLALVQFFLDVTPRGRWVLLNH
FAM178 |
---|
PFAM accession number: | PF14816 |
---|---|
Interpro abstract (IPR026161): | This entry represents the FAM178 family, whose members are metazoan proteins and include FAM178A and FAM178B. The human FAM178A protein has been shown to be widely expressed [ (PUBMED:12459258) ] and is phosphorylated upon DNA damage, probably by ATM (ataxia telangiectasia mutated) or ATR (ATM and Rad3-related) [ (PUBMED:17081983) (PUBMED:17525332) ]. FAM178A, also known as SLF2 (SMC5-SMC6 complex localization factor 2), forms a complex with RAD18 and SLF1, and together they define a pathway that suppresses genome instability by recruiting the SMC5/6 cohesion complex to DNA lesions [ (PUBMED:25931565) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM178