The domain within your query sequence starts at position 28 and ends at position 163; the E-value for the FAM180 domain shown below is 6.6e-60.
LFPAAHRPKRSLSLPLNPVLQTSLEEVELLYELLLAEIEISPDLEISIKDEELASLRKAL SFHSICNNIIPKRIPDIRRLSANLANHPGILKKEDFERITLTLAYTAYRTALSEGHQKDI WAQSLISLFQALRHDL
FAM180 |
---|
PFAM accession number: | PF15173 |
---|---|
Interpro abstract (IPR029170): | This family of proteins of unknown function is found in eukaryotes. Proteins in this family are typically between 117 and 182 amino acids in length. There are two conserved sequence motifs: ELAS and DFE. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM180