The domain within your query sequence starts at position 20 and ends at position 123; the E-value for the FAM183 domain shown below is 4.4e-34.
QILRELFLKELRAQKLYTQYHVNPLRKVHTITRKPMSWHDNLEEPEDAKFLNLIHHAAQG PKKKYSETQTEAQEIGWDPNPLINPDRQDHRLNHFRVYHDITLY
FAM183 |
 |
|---|
| PFAM accession number: | PF14886 |
|---|---|
| Interpro abstract (IPR029214): | The function of this family of proteins is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM183