The domain within your query sequence starts at position 44 and ends at position 104; the E-value for the FAM183 domain shown below is 5.4e-19.
LRKAKFLNLIHHAAQGPKKKYSETQTEAQEIGWDPNPLINPDRQDHRLNHFRVYHDITLY K
FAM183 |
---|
PFAM accession number: | PF14886 |
---|---|
Interpro abstract (IPR029214): | The function of this family of proteins is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM183