The domain within your query sequence starts at position 57 and ends at position 267; the E-value for the FAM184 domain shown below is 1.5e-84.

VIYALNTRNDEHDAAIQALKDAHEEEIQQILAETREKILLYKSKVTEELDLRRKIQVLEA
SLEDHMKMKQEALTEFEAYKRRVEDMQLCAEAQHVQRIVTMSREVEEIRKKFEERLRSFG
QLQVQFENDKQAALEDLRTTHRLEVQELLKSQQNHSSSVKLGQEKAEGLHRMEVEALNNT
VKELRLEKKQLIEEYEGKLSKAQVFYERELD

FAM184

FAM184
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM184