The domain within your query sequence starts at position 357 and ends at position 561; the E-value for the FAM194 domain shown below is 4.1e-68.
RHSQEWKGPKKPIKLHYTFYDGSSFIYYPSGNIALLQIPTCCRGKPITCLFNDMPNTFLA LFNAEGLGCVYYNLKNCCPYVLVLDEEGGITNDQKGYIVHRWSWASKTETLLSLEYKVNE QMKLTVLGQDSITVTFTSMNETVTISVSPKSCPHNVLHDKRPVRRISLMDEKVSKTNRAL AEIKKRFQKTVTQFMNSVLLAAGLF
FAM194 |
---|
PFAM accession number: | PF14977 |
---|---|
Interpro abstract (IPR029281): | This domain can be found in a group of uncharacterised proteins, including FAM194A, FAM194B and C3orf20. They are approximately 210 amino acids in length and have a conserved YPSG sequence motif. The function of this domain is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM194