The domain within your query sequence starts at position 357 and ends at position 561; the E-value for the FAM194 domain shown below is 4.1e-68.

RHSQEWKGPKKPIKLHYTFYDGSSFIYYPSGNIALLQIPTCCRGKPITCLFNDMPNTFLA
LFNAEGLGCVYYNLKNCCPYVLVLDEEGGITNDQKGYIVHRWSWASKTETLLSLEYKVNE
QMKLTVLGQDSITVTFTSMNETVTISVSPKSCPHNVLHDKRPVRRISLMDEKVSKTNRAL
AEIKKRFQKTVTQFMNSVLLAAGLF

FAM194

FAM194
PFAM accession number:PF14977
Interpro abstract (IPR029281):

This family is found in eukaryotes and includes uncharacterised proteins FAM194A, FAM194B and C3orf20. Proteins in this family are approximately 210 amino acids in length and have a conserved YPSG sequence motif. The function of this family is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM194