The domain within your query sequence starts at position 1 and ends at position 535; the E-value for the FAM196 domain shown below is 3.6e-196.

MAQQSMKVRPVLLKRSSLESVELVKQPHHRRSKSQQVRFKEDGNIKNPTGVTEVNTQTPE
DPGVMGKAQASRHHHPTTYSLSFPRSHKAGGFRSISIQTSPSLRKHFPVFKRKKLTTSKS
LVEMPTASPSAIQVNGNLSEQDIVSSDLAFLRLAQHLEDGPRRLKIPHPFLPRMPKVQSN
GPVSFCLESGTWMSSEKATAAIQVPDDICHSPTWEARESALSPESSAEESNSIPALISMC
PGDGQRVMTSELERMPPCSNTNSSASNMPGTEKLTPELLLPKDNPDDKDLGLPSSQSKKM
CVPSPPRTHSSPEPGSRSQPVHLGRSSDCPASGDNHQDLESLRSSSASKSVPVCWEHVTK
LPSQSDTPELQTGVGSEQLPASIPRQENRAQSSREIGGSNHSHLAQGELCDLQGRLQSVE
ESLHSNQEKIKVLLNVIQDLEKAHALTEGRNFYRTGQDLNNCSTCQNTACIIYSVEYDFR
QQEGRFHEVLQSLEEAEPTEEAPSPPKSPAEAPVPEKQDLRRKSKKVKKKCFWWI

FAM196

FAM196
PFAM accession number:PF15265
Interpro abstract (IPR029337):

This entry represent a group of eukaryotic proteins that are typically between 441 and 534 amino acids in length.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM196