The domain within your query sequence starts at position 220 and ends at position 544; the E-value for the FAM198 domain shown below is 1.3e-150.

AGTAAWGQVPPWFMEHDAQTLRLLVHGKVVGKARVPAHGQVLQVGLSAGDALQDISPLRL
SQFCSQGLCGLIKRSKDLHEVLSFHLDRVLGLQRSLPAVARSFHSPLLPYRYTDGSVRPI
IWWAPDVQHLRDPDEDQNSLALGWLQYQALLARGCKWPGQIPCLGIHHAEWARLALFDFL
LQVHDRLDRYCCGFEPEPSDPCVEEGLREKCRNPEELRLVHILVRSSDPSRLVYIDNAGN
LQHPEDKLNFRLLEGIDGFPESAVKVLASGCLQNLLFKSLQMDQVFWESQGGAAGLKHVL
ETLESRGQILLRHIKKHNLTLFRDK

FAM198

FAM198
PFAM accession number:PF15051
Interpro abstract (IPR029207):

This family of proteins is found in eukaryotes. The function of this family is unknown. Murine FAM198B is downregulated by FGFR signalling [(PUBMED:17174081)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM198