The domain within your query sequence starts at position 146 and ends at position 201; the E-value for the FAM212 domain shown below is 1.7e-30.

PRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVLGDNCFADLVHNWMELPEA

FAM212

FAM212
PFAM accession number:PF15342
Interpro abstract (IPR029267):

This entry represents a domain of approximately 60 amino acids found in a group of eukaryotic proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM212