The domain within your query sequence starts at position 30 and ends at position 157; the E-value for the FAM222A domain shown below is 8e-42.
SVASSMHSSRYPSPAELDAYAEKVANSPLSIKIFPTNIRVPQHKHLSRTVNGYDTSGQRY SPYPQHTAGYQGLLAIVKAAVSSSAHAPAGHPKSVLKSVEGKRTKLSPATVQVGIAPYPV PSTLGPLA
FAM222A |
---|
PFAM accession number: | PF15258 |
---|---|
Interpro abstract (IPR029340): | This entry represents a group of eukaryotic proteins that are typically between 411 and 562 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM222A