The domain within your query sequence starts at position 17 and ends at position 191; the E-value for the FAM47 domain shown below is 1.7e-31.
LLRERQNCGWYLGNLPPKRFIRRNRLTCQGFLNSRHWVFVKEDNFRKDCPPHQSPKDAFL PLIHRGAPSATPEKRQSTLLKGATLLSKLSKAGKAFLEDVEAEAAQHPLTLYPQLTEALP AELLLQVLEVLDPERKLEDVWAYCQDTRKPMKEPTELVGKRSSQERPPKKTLISR
FAM47 |
---|
PFAM accession number: | PF14642 |
---|---|
Interpro abstract (IPR032743): | The function of this family of proteins from metazoa is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM47