The domain within your query sequence starts at position 1 and ends at position 307; the E-value for the FAM53 domain shown below is 3.9e-87.

MITLITEQLQKQTLDELKCTRFSVSLPLPDHADIPNCGDPFQLVSEGASWRGLPHCSCAE
FQDSLNFSYHPSGLSLHLRPPSRGNSPKEPPLSQVLSPEPPDPEKLPVPPAPPSKRHCRS
LSVPVDLSRWQPVWRPAPSKLWTPIKHRGNAGGGGPQVPQQSPPKRVSSLRFLQAPSASS
QCAPAHRPYSPPFFSLALAQDSAQPCATSPQSGSWESDAESLSPCPPQRRFSLSPSLGPQ
ASRFLPSARSSPASSPELPWRPRGLRNLPRSRSQPCDLDARKTGVKRRHEEDCRRLRPSL
DFDKMNQ

FAM53

FAM53
PFAM accession number:PF15242
Interpro abstract (IPR029356):

This entry represents a group of eukaryotic proteins that bind to a transcriptional regulator and modulate cell proliferation [(PUBMED:16611694)]. They are known to be highly important in neural tube development [(PUBMED:11984880)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM53