The domain within your query sequence starts at position 1 and ends at position 54; the E-value for the FAM53 domain shown below is 4e-15.

MVTLITEKLQNQSLDDLTRRACEAGPYSAEKLNKSGHLFPLEISELRRQRQVDL

FAM53

FAM53
PFAM accession number:PF15242
Interpro abstract (IPR029356):

This entry represents a group of eukaryotic proteins that bind to a transcriptional regulator and modulate cell proliferation [ (PUBMED:16611694) ]. They are known to be highly important in neural tube development [ (PUBMED:11984880) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM53