The domain within your query sequence starts at position 1 and ends at position 54; the E-value for the FAM53 domain shown below is 4e-15.
MVTLITEKLQNQSLDDLTRRACEAGPYSAEKLNKSGHLFPLEISELRRQRQVDL
FAM53 |
---|
PFAM accession number: | PF15242 |
---|---|
Interpro abstract (IPR029356): | This entry represents a group of eukaryotic proteins that bind to a transcriptional regulator and modulate cell proliferation [ (PUBMED:16611694) ]. They are known to be highly important in neural tube development [ (PUBMED:11984880) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM53