The domain within your query sequence starts at position 2 and ends at position 133; the E-value for the FAM60A domain shown below is 8.1e-61.

FGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVK
RWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRMKSNQISKLQKEFKRHITS
QMRAQIQRWLPA

FAM60A

FAM60A
PFAM accession number:PF15396
Interpro abstract (IPR026065):

SIN3-HDAC complex-associated factor (also known as FAM60A) is found in eukaryotes. It has been shown to be a subunit of the Sin3 deacetylase complex (Sin3/HDAC), important for the repression of genes involved in the TGF-beta signaling pathway [ (PUBMED:22984288) ],[ (PUBMED:22865885) ].

Human FAM60A protein has been shown to be up-regulated in squamous cell carcinoma (SCC), adenocarcinoma (AC), colon, ovary, rectum and stomach tumors. Human FAM60A is phosphorylated upon DNA damage, probably by ATM or ATR [ (PUBMED:17525332) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM60A