The domain within your query sequence starts at position 1 and ends at position 68; the E-value for the FAM70 domain shown below is 8.2e-28.
MQPLPPPVPGPLALLDTTEGFARRKKISLWFVGSLLLVSTLILTIGLAATTRTENVTVGG YYPGIILV
FAM70 |
---|
PFAM accession number: | PF14967 |
---|---|
Interpro abstract (IPR028014): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 241 and 349 amino acids in length. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM70