The domain within your query sequence starts at position 5 and ends at position 149; the E-value for the FAM72 domain shown below is 3.9e-84.

NCTFKDRCVSILCCKFCKQVLSSRGMKAVLLADTDIDLFSTDIPPTNTVDFIGRCYFTGI
CKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYGINRLDATGVNLLL
WGNLPETEECTDEETLEISAEEYIR

FAM72

FAM72
PFAM accession number:PF14976
Interpro abstract (IPR026768): This family consists of functionally uncharacterised proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM72