The domain within your query sequence starts at position 128 and ends at position 474; the E-value for the FAM75 domain shown below is 4.6e-28.

QLFSYLKFLEVLIQQKFNQLLWGISSVISEAVVATAWASRKSSSGHKSVRFTDACDPVQA
LPLAKEPPQLFQDQHLPHQLLTPSLVGVTGVQKLENLPSSIPNQSRPSSQRRANRRAHPT
AEVGIQTSLPNVKECSTHRLDWKDIAGCNVQNCQAAISQPTDNSSRGTLPVKTITSAFIL
PEHYQMIHHHKKRQPEEKAINEGKQKGTHVRFCPSSELTQLQGTFQPNGDGYCKNLPEPN
QPGQPSILNSKSYKLSQMAGSVPTGVPLKRALANSDMLSTFKKNPSVGAKDLPCTSSCTP
GNSLESRNSVLRTDDLLSINTSKDLSFLDSNTKMKLEFSIMRHFEKC

FAM75

FAM75
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM75