The domain within your query sequence starts at position 149 and ends at position 431; the E-value for the FAM75 domain shown below is 1.7e-83.

QKLSYPKISEDHFQQKCDQLFWGLPSLHSESLVAAAWIPQTTSTLPSPFFLFNVISSVYP
IQLQDKMSPMLPHTHPLSYLDLQSPHLILSPLEFQTPALNLPVLLPSSLPYNSDFGTSYS
QSQSKPQYLPTEIKYNKKPSLAKQIENRSTLPLMVQKPQEAYDILAPNPSQDWVVSILPD
NFPICRELREKLEQHIQKWLIQHQWNFPHKIQVSEKMKELQNTVIGNCQTRDKPGTLQAL
GEHSNEGQKRKFQLEKESGKNLGPILGKISKDPIRGLEKTTAI

FAM75

FAM75
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM75