The domain within your query sequence starts at position 157 and ends at position 279; the E-value for the FAM75 domain shown below is 9.4e-9.

LDQESQDLHHVKSSVSLLSLDPNLTHTMSLHMDSMLSSHLPLLSPKVRGLLELHVKKWIH
FQKWGLPRRVEESLRQLMPDPTLFRRSRENPSSCTLSSSSKVTEDRTGIVSHKTSSLYSA
GQP

FAM75

FAM75
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM75