The domain within your query sequence starts at position 426 and ends at position 462; the E-value for the FAM75 domain shown below is 4.5e-9.

EKTTAIKDLENNLKAHLGTKSGQIDQGLTPLSMRQSW

FAM75

FAM75
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM75