The domain within your query sequence starts at position 453 and ends at position 628; the E-value for the FAM75 domain shown below is 1.2e-12.

PPYKEPHFLKVSPPIPLPEAAPPPSSTSPNESLDEPQRAQIGGVPFLTLSECKTLEWHLL
QRQLQLQWGLSAVIARPPRVQSHTQYKHKPWNKAKPRETLKFFGPGKPFSAFTRELFFIP
QHARKLLEFHLQKRLIHLRWGLPQRIQRSINMLLSSTDPQSLPCGGSRLPNVSISQ

FAM75

FAM75
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM75