The domain within your query sequence starts at position 66 and ends at position 99; the E-value for the FAM75 domain shown below is 7.4e-14.

DQVLYVKIPEGDLGQKHSQLFWGLPSLHSESIMA

FAM75

FAM75
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM75