The domain within your query sequence starts at position 99 and ends at position 149; the E-value for the FAM75 domain shown below is 2e-5.

LPVRSKRASGSSPQQTKLQLFSGLPSLYNESLKTIFLSSDGPSPLKLSICP

FAM75

FAM75
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM75