The domain within your query sequence starts at position 6 and ends at position 99; the E-value for the FAM86 domain shown below is 2.7e-42.

HEGATSLLQSFERRFLAARALPSFPWQSLEEKLKDPSGSELLLAILQRTVKHPVCVQHGP
SVKYARCFLSKLIKKHEAVPTEPLDALYEALAEV

FAM86

FAM86
PFAM accession number:PF14904
Interpro abstract (IPR029426):

This conserved domain can be found at the N terminus of EEF2KMT (also known as FAM86A), FAM86B and related proteins. EEF2KMT (also known as Efm3 in budding yeasts) catalyzes the trimethylation of eukaryotic elongation factor 2 (EEF2) on 'Lys-525' [ (PUBMED:25086354) (PUBMED:25231979) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM86