The domain within your query sequence starts at position 8 and ends at position 312; the E-value for the FAM91_N domain shown below is 2.8e-149.

HIRHNYPWSKLPTNVKQSLGNSQREYEKQVVLYSIRNQLRYRNNLVKHVKKDERKYYEEL
LKYSRDHLMLYPYHLSDIMVKGLRITPFSYYAGIMEDIMNSEKSYDSLPNFTAADCLRLL
GIGRNQYIDLMNQCRSSKKFFRRKTARDLLPMKPVEIAIEAWWVVQAGYITEDDIKICTF
PEKGAIDKIIDSGPQLSGSLDYNVVHSLYNKGFIYLDVPISDDSCIAVPPLEGFVMNRVQ
GDYFETLLYKIFVSIDEHTNVAELANVLEIDLSLVKNAVSMYCRLGFAHKKGQVINLDQL
HSSWK

FAM91_N

FAM91_N
PFAM accession number:PF14647
Interpro abstract (IPR028091): This domain is found at the N terminus of proteins from the FAM91 family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM91_N