The domain within your query sequence starts at position 1 and ends at position 217; the E-value for the FAM92 domain shown below is 4.8e-66.

MNVVLSRDSQVRAMENTVTNAERYFGQFCSLLASYTRKTARLRDKADQLVKQLIDFANTE
NPELRATIRDFAEDLAKVQDYRQAEVERLEAKVISPLKLYGAQIKQTRADIKKCKRVQNN
EIKQLEKLEKLRQKSPSDRQMISQAETSAQRASVDTNRSTLHLVETVDAFQEQKLKDLRR
IFSDFVTIEMVFHAKAVEVYSSAFQTLENYDLERDLQ

FAM92

FAM92
PFAM accession number:PF06730
Interpro abstract (IPR009602):

This family of proteins has a role in embryogenesis. During embryogenesis it is essential for ectoderm and axial mesoderm development [(PUBMED:17440976)]. It may regulate cell proliferation and apoptosis [(PUBMED:17646714)].

They have been shown to interact with Cby1 to promote ciliogenesis via regulation of membrane-remodeling processes [(PUBMED:27528616)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM92