The domain within your query sequence starts at position 51 and ends at position 139; the E-value for the FAM92 domain shown below is 6.3e-37.
MLRRNLDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINLYAS TETPNLKQGLKDFADEFAKLQDYRQAELY
FAM92 |
---|
PFAM accession number: | PF06730 |
---|---|
Interpro abstract (IPR009602): | This family of proteins has a role in embryogenesis. During embryogenesis it is essential for ectoderm and axial mesoderm development [ (PUBMED:17440976) ]. It may regulate cell proliferation and apoptosis [ (PUBMED:17646714) ]. They have been shown to interact with Cby1 to promote ciliogenesis via regulation of membrane-remodeling processes [ (PUBMED:27528616) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM92