The domain within your query sequence starts at position 51 and ends at position 139; the E-value for the FAM92 domain shown below is 6.3e-37.

MLRRNLDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINLYAS
TETPNLKQGLKDFADEFAKLQDYRQAELY

FAM92

FAM92
PFAM accession number:PF06730
Interpro abstract (IPR009602):

This family of proteins has a role in embryogenesis. During embryogenesis it is essential for ectoderm and axial mesoderm development [ (PUBMED:17440976) ]. It may regulate cell proliferation and apoptosis [ (PUBMED:17646714) ].

They have been shown to interact with Cby1 to promote ciliogenesis via regulation of membrane-remodeling processes [ (PUBMED:27528616) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM92