The domain within your query sequence starts at position 447 and ends at position 879; the E-value for the FANCAA domain shown below is 1.4e-196.

ANAGQKIKELLLDIGDVSERVSFLKKAVDQRNKAITSLNEAMNVSCALLSHPEGDRPIAC
TITTSWSRLELRDMLMATCTLENSSSFSLDQGWTLCIQVLTSSSALDLDGTGSAFTYTIP
VDRLGPGSRREVTLPLGPSESGVLDLPVTMSCWLFYSLREVVGAALAPSDPLEAPYLEQF
PLSLPKQEGVCLPLCKRTVDMLQCLRFAGAATHPAQAPCMPGPACEPVETFLKTCQAPGS
EPTGAASLRAKYLPPSTASIRVSAGLLRAALEDSHSGFHLCSATLRWLLAENAAVDVVRA
QTLSSIQGIAPDGTDVNLTVHEVAVTDLSPAGPIQAVEIQVESSSLANMCRAHHAIIRRI
QTMVTEQAALGSSPPDLRMQYLQQIHANHQELLREVQALRDQLCTEDELSSCSTAQKLLH
IYKQLRNPSLVLL

FANCAA

FANCAA
PFAM accession number:PF15146
Interpro abstract (IPR029251):

Fanconi anemia-associated protein of 100 kDa (FAAP100) is component of the Fanconi anemia (FA) core complex, which plays a central role in FA-associated DNA damage response. FAAP100 is essential for the stability and function of the complex [(PUBMED:17396147)].

GO process:DNA repair (GO:0006281)
GO component:Fanconi anaemia nuclear complex (GO:0043240)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FANCAA