The domain within your query sequence starts at position 34 and ends at position 145; the E-value for the FANCA_interact domain shown below is 6.1e-45.
SKSEPWAALLRSTVSGTADWTPNRQPLPPLPAFPSQESLPDPESTVPPEAFTVGSKTFSW TPLPPALRGSGSSRHLFCEPEGSLGSPTPSLKGCPALNSGRTPSAQECVPVQ
FANCA_interact |
![]() |
---|
PFAM accession number: | PF15751 |
---|---|
Interpro abstract (IPR031491): | This domain is found in the N-terminal of Fanconi anemia-associated protein of 20kDa (FAAP20), where it is responsible for interaction with Fanconi anemia group A protein (FANCA) [ (PUBMED:22396592) ]. The Fanconi anemia (FA) pathway participates in interstrand cross-link repair and the maintenance of genomic stability. FAAP20 is a component of the FA core complex. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FANCA_interact