The domain within your query sequence starts at position 1 and ends at position 336; the E-value for the FANCF domain shown below is 3.4e-105.

MEPLVQQTERFSELLAVSCGSLVSTWDAEKVRRALQWARYLLHVYRRFAGRGRVREALER
RLPARGGPLGLRSFAALESGDARLALRLLRNRALAPAAARALPSLLFPGPAADHRDDVPQ
SRLVLLARRGSALRLLCRLGGDAPRSALLRTHAELLDARLHELGGADSAAARKLLDTLWT
RGPREHVLDVTAEALLLREEDPEPAQATDPAGADETQKLLRWLLESPEVLAAFCRHLPAK
RLASVAGCHHALSRAYLDLLTTWATRLHYDLQKGAWVPTQMEDMPWEELCLRLQSLCHAQ
PFLQEEVLVTLRSRKALDGDFEVPGMSIWTDLLVVL

FANCF

 FANCF
PFAM accession number:PF11107
Interpro abstract (IPR035428):

Fanconi anemia (FA) is a human disorder characterized by cancer susceptibility and cellular sensitivity to DNA crosslinks and other damages. The FA complex repairs the interstrand cross-linking (ICL) lesions and coordinates activities of the downstream DNA repair pathway including nucleotide excision repair, translesion synthesis, and homologous recombination. It is required for the monoubiquitylation of FANCD2 and FANCI heterodimer. The FA core complex consists of FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL, FANCM, FANCT (UBET2), FAAP100 and FAAP24 [ (PUBMED:29017571) (PUBMED:20347428) ].

Fanconi anemia group F protein (FANCF) is a component of the FA core complex [ (PUBMED:16357213) (PUBMED:17768402) ]. FANCF regulates its own expression by methylation at both mRNA and protein levels. Methylation-induced inactivation of FANCF has an important role on the occurrence of ovarian cancers by disrupting the FA-BRCA pathway [ (PUBMED:16418574) ].

This entry also includes homologues from plants.

GO process:interstrand cross-link repair (GO:0036297)
GO component:Fanconi anaemia nuclear complex (GO:0043240)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FANCF